Tippmann US Army Alpha Black Elite Tactical Rivalry Paintball Gun Package Kit - Tan

Customer Rating
Availability: Usually Ships in 24 to 48 Hours
Product Code: TIPPMANNRIVALRYKIT-ALPHAELITET
$389.74
Blue warning Badge

Item Out of Stock

Product Description
Tippmann Alpha Black Elite

Patterned after the formidable M4 Small Arms Rifle, the new US Army Alpha Black paintball gun offers authentic looking realism right out of the box. Manufactured by Tippmann Sports, Alpha Black boasts an in-line bolt system, all-aluminum die cast receiver, stainless steel gas line and quick release feeder elbow.

First Image

Tippmann Alpha Black Elite Paintball Gun

The Alpha Black Elite is made in collaboration with the US Army. This marker has an authentic M4 appearance that’s perfect for scenario games. This really gives the user a feeling as if they were on the real battlefield! The Alpha Black Elite is a semi-automatic paintball gun that can use CO2 or Compressed Air. A 6-point collapsible stock comes standard as well as a removable carry handle. As with all Tippmann guns, the Alpha Black Elite is durable, reliable and easy to maintain. This gun won’t let you down!

Fourth Image

HK Army HSTL Thermal Paintball Mask

The HSTL goggle features an optically correct high-definition dual pane thermal lens that prevents fogging, giving you a perfectly clear view of the field. A quick-change lens retention system allows you to swap between lenses easily in a flash. The HSTL mask is loaded with vents that promotes superior breathability and hearing.

Fifth Image

Planet Eclipse Protoyz Speedster Loader

The Protoyz Speedster Loader is an electronic loader with a feed rate of 10+ Balls Per Second. This loader can work with both 68 caliber and 50 caliber paintballs with the included 50 caliber adapter. Capacity for 68 caliber paint is 210 balls and 500 balls for 50 caliber paint. Toolless assembly makes maintenance a breeze. The GRN construction is as tough as it gets and will hold up to years of abuse.

Second Image

Empire 48/3000 High Pressure Air Tank

Empire's 48 cubic inch 3000 Psi bottle is a high-quality aluminum high pressure air tank. The regulator features an aluminum bonnet with dual burst disks for safety. The output pressure is 800 psi and is not adjustable. This tank is DOT & TC stamped which makes it good for use in the U.S. and Canada. The Empire 48/3000 will deliver 500-700+ shots per fill depending on your marker, with more consistent velocity, higher performance and improved accuracy over CO2. This tank has a five-year hydro test date requirement over a 15 year lifespan. All Compressed Air tanks are empty when shipped.

Fifth Image

Empire Omega 4 Pod Pack

The Empire Omega 4 Pod Pack is an entry level harness capable of holding (4) 140-round pods. Each pod holder includes a Velcro strap with extended rubber grip as well as pod ejection loops to make reloading easier. The waist belt includes Velcro and is adjustable to fit most players.

Second Image

HK Army HSTL Pods

HK Army HSTL Pods hold 150 rounds of .68 caliber paintballs. Paintballs can be seen through the translucent pod once filled. These are designed with an ergonomic feel for superior grip, form, and function when needed. HSTL pods are made of a strong plastic from the top to bottom, allowing them to handle the most rugged of terrains. The exterior is textured for superior grip.

Fifth Image

ANS Flex Barrel Swab

Anyone who plays paintball knows that ball breaks can occur Randomly leaving your barrel filled with paint and paint shell pieces. Featuring a thick swab on both ends, the ANS Flex Swabs fills the inner diameter of your barrel reaching every crevice. Its super absorbent material leaves no paint or residue behind. The flexible material under the swab makes it easier to carry it in your pocket so you can have access to it on the field.


12" High Performance Barrel Easy To Engage Recessed Safety Easy Pull Trigger Heavy Duty Braided Steel Gas Line Easy Access Velocity Adjusting Screw Quick Release Feed Elbow Added Bonus - Teamwork And Strategy Training Manual Included
warning icon

WARNING: Cancer and Reproductive Harm – www.P65Warnings.ca.gov/product

Customer Reviews